PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00246.1.g00060.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 326aa    MW: 35962.6 Da    PI: 4.6845
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00246.1.g00060.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox598.1e-1977129456
                                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     ++++  eq+++Le+ Fe +++++  +++++A++lgL+ rqV vWFqNrRa++k
  Zpz_sc00246.1.g00060.1.sm.mkhc  77 KRRLALEQVRALERSFETDNKLDPGRKARIARELGLQPRQVAVWFQNRRARWK 129
                                     4467789*********************************************9 PP

2HD-ZIP_I/II128.13.7e-4175167193
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl+ eqv++LE+sFe+++kL+p rK+++areLglqprqvavWFqnrRAR+ktkqlE+d++aL++++d+l+++ ++
  Zpz_sc00246.1.g00060.1.sm.mkhc  75 EKKRRLALEQVRALERSFETDNKLDPGRKARIARELGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDSLRADCDA 153
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelke 93 
                                     L++++++L++e++e
  Zpz_sc00246.1.g00060.1.sm.mkhc 154 LRRDKDALAAEIRE 167
                                     *********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.84E-1874133IPR009057Homeodomain-like
SMARTSM003895.6E-1974135IPR001356Homeobox domain
PROSITE profilePS5007116.5275131IPR001356Homeobox domain
CDDcd000862.15E-1776132No hitNo description
PfamPF000464.7E-1677129IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-1983130IPR009057Homeodomain-like
PRINTSPR000311.6E-5102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5111127IPR000047Helix-turn-helix motif
PfamPF021832.7E-15131172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MKRPTSSHEP TEPVDNHRLE ILSDSKLNDG HIAGDKLPFP EEENLTARSK ETEMDDDEDE  60
LADGRAARSA WGLGEKKRRL ALEQVRALER SFETDNKLDP GRKARIAREL GLQPRQVAVW  120
FQNRRARWKT KQLERDFAAL RARHDSLRAD CDALRRDKDA LAAEIRELRQ KLSKPEAAVK  180
VEATCNDAVE DRQAAFGASA TIAVYKDGSS DSDSSVVFND VEASPYSGAV LEQPPQQAGF  240
VGFGESFMDS SAAATMGCPS FGTKWQHGSM TYPCDDPYKA GSYGIIEEWL AGSDVISNDG  300
AAGFFSDEHA PSLNFSWCAS VAEGWD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123131RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699251e-138JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465732.11e-119hypothetical protein SORBIDRAFT_01g044620
SwissprotQ10QP35e-97HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ11e-135A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGSb01g044620.11e-119(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.11e-32homeobox protein 16